DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and CG7857

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster


Alignment Length:122 Identity:27/122 - (22%)
Similarity:51/122 - (41%) Gaps:23/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TEVRK-ARDPIDRFLE---------RRQLFRKHMLGDASSLFRVVAEQVYDTQMLHY---EVRME 62
            ||::. |..|..:.:|         :|||...::..|...|::.:..|:....:..:   |:|.|
  Fly   144 TELQNAANQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREE 208

  Fly    63 CVRYMFTKWKTFRRFV----SGD------FDEYLWHLGKTKTAGTILELGAMCHLYR 109
            ...|:.....:...::    :||      |::|...:.||...|..:||.|:..|.|
  Fly   209 TANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 19/87 (22%)
CG7857NP_648769.2 COG5539 17..307 CDD:227826 27/122 (22%)
OTU 178..305 CDD:280496 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.