DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud6b

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_956519.1 Gene:otud6b / 393194 ZFINID:ZDB-GENE-040426-974 Length:293 Species:Danio rerio


Alignment Length:180 Identity:40/180 - (22%)
Similarity:74/180 - (41%) Gaps:43/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLASTEVR-----------KARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQML--HYE 58
            |:|..||.           |.|:.    |..|.|..|.:..|...::|.|..|:.:..:.  ..|
Zfish   118 RIAEAEVENLSGSRHQEGLKLREK----LVERHLQIKEISSDGHCMYRAVEHQLTERGLALGLKE 178

  Fly    59 VRMECVRYMFTKWKTFRRFV----SGD------FDEYLWHLGKTKTAGTILELGAMCHLYRRNVI 113
            :|.:..:||.:....|..|:    :||      |::|...:..|...|..|||.|:      :.:
Zfish   179 LRDQTAQYMRSHADDFMPFLTNPNTGDMYTAEEFEKYCSDVADTAAWGGQLELKAL------SQV 237

  Fly   114 IYEPFDM----GRMVTYNKDY--KEILRIFMN---SMG-HFETVLTMQDV 153
            :..|.::    ...:|..::|  .:|..|:|.   .:| |:.:|..::|:
Zfish   238 LQLPIEVIQADSPCITIGEEYDKPKITLIYMRHAYGLGEHYNSVEPLKDL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 20/90 (22%)
otud6bNP_956519.1 TMPIT 1..>67 CDD:285135
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
COG5539 2..282 CDD:227826 38/173 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..114
Cys-loop. /evidence=ECO:0000250 152..158 1/5 (20%)
OTU 154..278 CDD:280496 27/129 (21%)
Variable-loop. /evidence=ECO:0000250 219..229 2/9 (22%)
His-loop. /evidence=ECO:0000250 267..277 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.