DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud5

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006256799.1 Gene:Otud5 / 363452 RGDID:1563027 Length:640 Species:Rattus norvegicus


Alignment Length:183 Identity:49/183 - (26%)
Similarity:81/183 - (44%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDEYLWHL 89
            :::....|.|..|.:.|||.||:|||..|.:|..||..|:.|:......|..:|:.||..|:...
  Rat   282 DKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRK 346

  Fly    90 GKTKTAGTILELGAMCHLYRRNVIIY----EPFDMGRMVTYNKDYKEILRIFMNSMGHFETVLTM 150
            .|....|..:|:.||..:|.|.|.:|    ||.:....:..|:|  |.:|:..:...|:.:|:..
  Rat   347 RKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNED--EPIRVSYHRNIHYNSVVNP 409

  Fly   151 QDVDMAAVCQSVSFK------MLYKHLFRLPDVDLAVEWMLYPDTFKMGTEYE 197
            ....:.......|||      .|.|:..:..:.....:.||  :..|..|::|
  Rat   410 NKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQML--EDKKRATDWE 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 28/78 (36%)
Otud5XP_006256799.1 OTU 294..403 CDD:303090 35/110 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.