DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud4

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001178629.1 Gene:Otud4 / 307774 RGDID:1305606 Length:1105 Species:Rattus norvegicus


Alignment Length:441 Identity:124/441 - (28%)
Similarity:196/441 - (44%) Gaps:79/441 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFD 83
            |:|.:|.:..|:||.:..|.|.|||.|||||..:|..|.||||.|:||:....:.|..|:.|.|:
  Rat    24 PMDAYLRKLGLYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIRYLRDNREKFEAFIEGSFE 88

  Fly    84 EYLWHLGKTKTAGTILELGAMCHLYRRNVIIY-EPFDMGRMVTYNKDYKEILRIFMNSMGHFETV 147
            |||..|...:.....:|:.|:..:||::.:|| ||......||.|...:::|..|.|. .|::.|
  Rat    89 EYLKRLENPQEWVGQVEISALSLMYRKDFVIYQEPNVSPSHVTENNFPEKVLLCFSNG-NHYDIV 152

  Fly   148 LTMQDVDMAAVCQSVSFKMLYKHLFRLPDVDLAVEWMLYPDTFKMGTE-------YEFDS-RGRA 204
            ..:...|.:|||||:.:::||:.:|: .||.   :.|:..:|.::..|       .|.|| :.::
  Rat   153 YPITYRDSSAVCQSLLYELLYEKVFK-TDVS---KIMMGLETSEVADESNSEISDSEDDSCKSKS 213

  Fly   205 IRLLCRNGRSFKLDRPESTICLLENSQMCPFHNRRLAMGGQFADFSCMRILLEENNIPFSYLVAK 269
            ......||  ||....|:           |.::      |..||            :|.|..|.|
  Rat   214 TAATDVNG--FKSSGSEN-----------PKNH------GNSAD------------LPLSRKVLK 247

  Fly   270 SMDPCRYRNVELTSAIEAR--REAYEFGIYIGDYNFKVGAKCQVQLDTNRRDLLSACYIQSIDKK 332
            |:.|..|||||....::::  ::..::.|..| ..::.|.:|.|:||.|.:  ||...|..:..:
  Rat   248 SLSPAVYRNVEYEIWLKSKQAQQKRDYSIAAG-LQYEGGERCHVRLDHNGK--LSNADIHGVHSE 309

  Fly   333 KSVCKVFIEEQGKLVDVPSDNLHPLPPDEFKAWDFARKRPQRLHNSQMGRQSVQGDQQGFVPDPM 397
            ..  .|..||.|| ...|. ||.|.||:   :|:....:..:..||.....| ..|.:|      
  Rat   310 NG--PVLSEELGK-KQTPK-NLKPPPPE---SWNTVSGKKMKKPNSGQNFHS-DTDYRG------ 360

  Fly   398 PGTAPSMPPPPVADPRPVNVTAQQPPVFGPSRWMEPTRPLMPNPLMIHQTG 448
                          |:.:|...:.|... |.|...|...:..:.|..|.||
  Rat   361 --------------PKNLNKPIKAPSAL-PPRLQHPPAGVRQHALSSHSTG 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 31/78 (40%)
Otud4NP_001178629.1 OTU 42..>121 CDD:303090 32/78 (41%)
T4BSS_DotH_IcmK 556..>642 CDD:289093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338854
Domainoid 1 1.000 65 1.000 Domainoid score I9797
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46056
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1801
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.