DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud6b

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038965351.1 Gene:Otud6b / 297911 RGDID:1310024 Length:333 Species:Rattus norvegicus


Alignment Length:169 Identity:37/169 - (21%)
Similarity:72/169 - (42%) Gaps:31/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRLASTEVRK---AR----DPIDRFLERRQLFRKHMLGDASSLFRVVAEQV--YDTQMLHYEVRM 61
            :|:|..|:..   ||    :.:.:.|..|:|..||:..|...::..:.:|:  .|:.:....:|.
  Rat   148 ERIAEAEIENLSGARHLESEKLAQILAARELEIKHIPSDGHCMYGALEDQLREQDSALTVATLRR 212

  Fly    62 ECVRYMFTKWKTFRRFV----SGD------FDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYE 116
            :...||.:....|..|:    :||      |.:|...:..|...|..|||.|:.|:.:..:.|.:
  Rat   213 QTAEYMQSHSDDFLPFLTNPNTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILKTPIEILQ 277

  Fly   117 ----PFDMGRMVTYNKDYKEILRIFMN---SMG-HFETV 147
                |..:|.....|    .::.::|.   .:| |:.:|
  Rat   278 ADAPPIIVGEEYPRN----PLVLVYMRHAYGLGEHYNSV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 19/90 (21%)
Otud6bXP_038965351.1 COG5539 43..311 CDD:227826 36/166 (22%)
OTU 184..309 CDD:396767 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.