DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD3

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_005245849.1 Gene:OTUD3 / 23252 HGNCID:29038 Length:465 Species:Homo sapiens


Alignment Length:139 Identity:37/139 - (26%)
Similarity:62/139 - (44%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGD--FDEYLWHLGKTKTAGTI 98
            ||.:.|||.:.:|:......|.:.|.|.|.||..:.:.|..||..|  |::::..|.|..|....
Human   147 GDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGN 211

  Fly    99 LELGAMCHLYRRNVIIYE---PFDMGRMVTYNKDYKEILRIFMNSMGHFETVLTMQDVDMAAVCQ 160
            ..:.|....::.||:|::   |....| .|.....:| |.|......|:::|..:.|...|....
Human   212 DAIVAFARNHQLNVVIHQLNAPLWQIR-GTEKSSVRE-LHIAYRYGEHYDSVRRINDNSEAPAHL 274

  Fly   161 SVSFKMLYK 169
            ...|:||::
Human   275 QTDFQMLHQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 23/80 (29%)
OTUD3XP_005245849.1 OTU 146..>232 CDD:303090 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.