DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD1

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001138845.1 Gene:OTUD1 / 220213 HGNCID:27346 Length:481 Species:Homo sapiens


Alignment Length:175 Identity:40/175 - (22%)
Similarity:70/175 - (40%) Gaps:32/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVRKARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRR 76
            ||.|.    |::|.:|..:|.|::.|.:.|:|.|::.||..|.||.|:|.:.|.|:......|..
Human   296 EVEKQ----DKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSP 356

  Fly    77 FVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVII-----YEPFDMGRMVTY---NKDYKEI 133
            .:.||..|::....:........||.||..:...|:.:     .|...:..|:.|   ....:..
Human   357 LIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPS 421

  Fly   134 LRIFMNSMGHFETVLTMQDVDMAAVCQSVSFKMLYKHLFRLPDVD 178
            :.:...|.||::.|                    :.|.:..|:.|
Human   422 IWLSWLSNGHYDAV--------------------FDHSYPNPEYD 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 22/83 (27%)
OTUD1NP_001138845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..282
Cys-loop 314..320 1/5 (20%)
OTU 315..432 CDD:280496 27/116 (23%)
His-loop 369..379 0/9 (0%)
Variable-loop 426..431 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4984
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.