DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and algn-13

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_506467.1 Gene:algn-13 / 179890 WormBaseID:WBGene00011193 Length:179 Species:Caenorhabditis elegans


Alignment Length:110 Identity:24/110 - (21%)
Similarity:39/110 - (35%) Gaps:20/110 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 FGIYIGDYNFKVGAKCQ-VQLDTNRRDLLSACYIQSIDKKKSVCKVFIEEQGKLVDVPSDNLHPL 357
            ||...||   :...||. :.:|..|       |..|:.:..:...:.|...|....:....|| |
 Worm    54 FGETSGD---EGSVKCDGLDIDYYR-------YKPSLSEDMAEALIVIGHGGAGTCLEVLALH-L 107

  Fly   358 PPDEFKAWDFARKRPQRLHNSQMGRQSVQGDQQGFVPDPMPGTAP 402
            |        |......:|.::.....:||...:|::....|.|.|
 Worm   108 P--------FITVTNDKLMDNHQAELAVQLSDEGYLLQCTPSTLP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090
algn-13NP_506467.1 Glyco_tran_28_C 3..173 CDD:367813 24/110 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.