DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otub-4

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_500333.3 Gene:otub-4 / 177104 WormBaseID:WBGene00015249 Length:436 Species:Caenorhabditis elegans


Alignment Length:113 Identity:34/113 - (30%)
Similarity:58/113 - (51%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVRKARD-----PIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKW 71
            |::..||     .....|..|.|..|.|:||.:.:||.:|||:|..|.:|.::|..|:.||....
 Worm   113 EMQNIRDDEIETEFSNRLAARGLIIKEMVGDGACMFRSIAEQIYGDQEMHGQIRRLCMDYMSNNR 177

  Fly    72 KTFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYEPFD 119
            ..|:.|::.:|:.|:....:....|..:||.|:..::.|.|.:|:..|
 Worm   178 DHFKEFITENFENYIQRKREENVHGNHVELQAISEMFARPVEVYQYSD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 24/78 (31%)
otub-4NP_500333.3 OTU 142..277 CDD:388712 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.