DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD6A

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_997203.1 Gene:OTUD6A / 139562 HGNCID:32312 Length:288 Species:Homo sapiens


Alignment Length:171 Identity:38/171 - (22%)
Similarity:77/171 - (45%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEVLQRLASTEVRKARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVR- 65
            :|:.:.||..: |:..:.:...|..|.|..|.:..|...::|.:.:|      |.:.|.:|.:| 
Human   115 AEMSEHLAGFK-REEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQ------LVFSVSVEMLRC 172

  Fly    66 ----YM----------FTKWKTFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYE 116
                ||          |:..:|...|...||..|..::.:|...|..|||.|:.|:.:..:.:.:
Human   173 RTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQ 237

  Fly   117 PFDMGRMVTYNKDY--KEILRIFMN---SMG-HFETVLTMQ 151
            . |...:: ..::|  |.|:.:::.   |:| |:.:|..::
Human   238 A-DSPTLI-IGEEYVKKPIILVYLRYAYSLGEHYNSVTPLE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 22/93 (24%)
OTUD6ANP_997203.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
COG5539 5..271 CDD:227826 37/164 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..110
Cys-loop. /evidence=ECO:0000250 146..152 1/5 (20%)
OTU 147..269 CDD:280496 28/129 (22%)
Variable-loop. /evidence=ECO:0000250 210..220 2/9 (22%)
His-loop. /evidence=ECO:0000250 258..268 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.