DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud1

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_005162641.1 Gene:otud1 / 100537398 -ID:- Length:426 Species:Danio rerio


Alignment Length:157 Identity:40/157 - (25%)
Similarity:72/157 - (45%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEVLQRLASTEVRKARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRY 66
            ::|.:.||..|.:      :::|..||.:|.|::.|.:.|:|.|::..|..|.:|.|:|.:.:.:
Zfish   233 NKVTRYLAEVEKQ------NKYLHDRQKYRFHIIPDGNCLYRAVSKAAYGDQSMHKELREQTMHH 291

  Fly    67 MFTKWKTFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIY-------EPFDMGRMV 124
            :....:.|...:.||..|:|.:..:........||.||..:.  ||.||       |...:..||
Zfish   292 IADHLEEFNPIIEGDVGEFLINAAQDGAWAGYPELLAMSQML--NVNIYLTTGGSVESPTVSTMV 354

  Fly   125 TY---NKDYKEILRIFMNSMGHFETVL 148
            .|   ....|..:.:...|.||::.:|
Zfish   355 HYLGEEDSSKPAIWLSWLSNGHYDVLL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 20/78 (26%)
otud1XP_005162641.1 OTU 260..377 CDD:303090 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.