DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11929 and C3orf49

DIOPT Version :9

Sequence 1:NP_608849.1 Gene:CG11929 / 33668 FlyBaseID:FBgn0031620 Length:919 Species:Drosophila melanogaster
Sequence 2:XP_024309121.1 Gene:C3orf49 / 132200 HGNCID:25190 Length:293 Species:Homo sapiens


Alignment Length:257 Identity:57/257 - (22%)
Similarity:105/257 - (40%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 KQNDT--EHGVE--------NLLGEIVKKPKSKVSSTSCLEAKSSEQSNKSVEKELYKSFIEQLI 599
            |:|.:  ..|:|        |||.:.|..||.:.||.|.:....|:|:.||..|...|:...:::
Human    30 KKNGSFKRKGIERWHRAVSTNLLKQNVLVPKEESSSDSDMGFHESQQNQKSNLKTKVKTAFGRML 94

  Fly   600 SHFTKSK-SCENNQAQNAQSESY--SFDRLLPEFVKMFTRSNSLEEDRPKKVS------------ 649
            |:..:|| :|.:.:......|:.  :...|||..||.|: |..|...:.:|:|            
Human    95 SYKYRSKPACASQEGSTDHKEALLSNTQSLLPRIVKEFS-SPKLFTAKMRKLSENATIQLDVVEA 158

  Fly   650 ----ISEKKTILGANPMTS---------------FNCSKTPH----NIKSTALKSELKTSDMELD 691
                |::..|:|.|...|.               ::..|.||    ..|...:::.|:.||:.: 
Human   159 ETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPHFPALKKKKRGMENILRKSDLTV- 222

  Fly   692 ANGRRGSCQLEGESKPSAIFRNTQRM----NNPPRGCQYCGDGSLPILDSLMDEIFRLIGQR 749
                 |..|::.:.....:...:.::    :...:.|::.||   .||.|  .:.|:.|.:|
Human   223 -----GKLQMQVDDLIETVTDKSMKLLAQRHAELQQCEFLGD---EILQS--SKQFQRISKR 274



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.890

Return to query results.
Submit another query.