DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11929 and LOC102550375

DIOPT Version :9

Sequence 1:NP_608849.1 Gene:CG11929 / 33668 FlyBaseID:FBgn0031620 Length:919 Species:Drosophila melanogaster
Sequence 2:XP_008768866.1 Gene:LOC102550375 / 102550375 RGDID:7634115 Length:294 Species:Rattus norvegicus


Alignment Length:278 Identity:59/278 - (21%)
Similarity:100/278 - (35%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 QCLKDTENFLEQFNRVFAKTKSEETLSDK--SRNTSAFSANPTKQN--------------DTEHG 552
            :.||.....:.|:.|:....:...:...|  .|...|.|::..|||              ....|
  Rat    10 ELLKLAYRKIGQYQRIQQPKRKSGSFKGKGIERWQRAVSSHLAKQNVLVPKEESLNESDVGFHEG 74

  Fly   553 VENLLGEIVKKPKS---KVSSTSCLEAKSSEQSNKSVEKELYKSFIEQLISHFTKSKSCENNQAQ 614
            ..|....:|||.||   |:.|..|    .|:.:|...|     ||:||      |.....|.|. 
  Rat    75 RSNRKRNLVKKMKSAVGKMLSCKC----GSQSANAGRE-----SFVEQ------KGAVPSNTQG- 123

  Fly   615 NAQSESYSFDRLLPEFVK------MFT--RSNSLEEDRPKKVSISEKKT--ILGANPMTSFNCSK 669
                       |||..||      :||  |...|.:....::.:.|.:|  :.|.|.:  ....:
  Rat   124 -----------LLPRLVKELPSPRLFTKPRMRKLSQTATIQLDVVEAETEEVTGGNGL--LRAKR 175

  Fly   670 TPHNIKSTALKSELKTSDMELDANGRRGSCQLEGESKPSAIFRNTQRMNNPPRGCQYCGDGSLPI 734
            |...:..|:|.|.|:.:  ...:..|.....|:.:....||.|.::..         .|:..:.:
  Rat   176 TTKRLSVTSLPSGLQKA--PYSSKKRPHFPALKKKQSMQAILRKSELT---------VGELQMQV 229

  Fly   735 ---LDSLMDEIFRLIGQR 749
               ::::.|:..:|:.||
  Rat   230 DDLIETVTDKSMKLLEQR 247



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.