DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:273 Identity:105/273 - (38%)
Similarity:145/273 - (53%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RNQCTAKQ----NCF-CGT-PNVNRIVGGQQVRSNKYPWTAQLVKG-RHYPRLFCGGSLINDRYV 114
            ||.||:.|    .|. ||. |..:||||||.|...::||.|.:..| ||    .||||::..|:|
Human   193 RNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRH----TCGGSVLAPRWV 253

  Fly   115 LTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRK----------VVQTTVHPNYDPNRIVNDVALL 169
            :|||||:|      :.||.::.......|:|..          |.:...||.|.......|||||
Human   254 VTAAHCMH------SFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALL 312

  Fly   170 KLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGV-TSNYLQEVNVPVITNAQCRQT 232
            :|::.:..:..:..||||....:| .|....|:|||....... :|:.||:..||:.:...|..:
Human   313 RLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSS 377

  Fly   233 -RYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEG-RYKLAGVVSFGYGCAQKNAPGVYARV 295
             .|...:...|||||.: .|..|||||||||||:..:| .::|.||||:|.|||:.|.|||||:|
Human   378 CVYSGALTPRMLCAGYL-DGRADACQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKV 441

  Fly   296 SKFLDWIRKNTAD 308
            ::|||||.....|
Human   442 AEFLDWIHDTAQD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 93/241 (39%)
Tryp_SPc 76..305 CDD:238113 94/243 (39%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 8/19 (42%)
Tryp_SPc 217..448 CDD:214473 93/241 (39%)
Tryp_SPc 218..451 CDD:238113 94/243 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.