DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss5

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:254 Identity:100/254 - (39%)
Similarity:136/254 - (53%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGT-PNVNRIVGGQQVRSNKYPWTAQLVKG-RHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITI 130
            ||. |..:||||||.|.|.::||.|.::.| ||    .||.|::...:|:|||||::..|     
Mouse   209 CGARPLASRIVGGQAVASGRWPWQASVMLGSRH----TCGASVLAPHWVVTAAHCMYSFR----- 264

  Fly   131 RLLQIDRSSR--------DPGIVRKVVQTTV-----HPNYDPNRIVNDVALLKLESPVPLTGNMR 182
                :.|.|.        ..|.||:...|.|     ||.|.......|||||:|.:|:..:..:.
Mouse   265 ----LSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVG 325

  Fly   183 PVCLPEANHNFD-GKTAVVAGWGLIKEGGV-TSNYLQEVNVPVITNAQCRQT-RYKDKIAEVMLC 244
            .||||....:|. |....|:|||....... :|:.||:..||:::...|..: .|...:...|||
Mouse   326 AVCLPAKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRMLC 390

  Fly   245 AGLVQQGGKDACQGDSGGPLIVNEG-RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            ||.: .|..|||||||||||:...| .:.|.||||:|.|||:.|.|||||:|::|||||
Mouse   391 AGYL-DGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 95/244 (39%)
Tryp_SPc 76..305 CDD:238113 96/245 (39%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 2/3 (67%)
Tryp_SPc 217..448 CDD:214473 95/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.