DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and prss60.1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:258 Identity:102/258 - (39%)
Similarity:137/258 - (53%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG-TPNVNRIVGGQQVRSNKYPWTAQL---VKGRHYPRLFCGGSLINDRYVLTAAHCVH------ 122
            || .|..||||||.......:||...|   :.|.|    ||||||||..:|||||||:.      
Zfish    25 CGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGH----FCGGSLINSEWVLTAAHCLPRITTSS 85

  Fly   123 -----GNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMR 182
                 |...|..:...:|:|:         |...||||:|:.....||:|||.|.|.|..:..:|
Zfish    86 LLVFLGKTTQQGVNTYEINRT---------VSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIR 141

  Fly   183 PVCLPEANHNF-DGKTAVVAGWGLIKEG------GVTSNYLQEVNVPVITNAQCRQTRYKDKIAE 240
            ||||...|..| :|.::.:.|||.|:.|      |:    |||..:||:.|.||........:..
Zfish   142 PVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGI----LQETMIPVVPNDQCNALLGSGSVTN 202

  Fly   241 VMLCAGLVQQGGKDACQGDSGGPLIVNEGR-YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            .|:||||: |||:|.||||||||::..:.. :..:|:.|:|||||...:||||.|||::..||
Zfish   203 NMICAGLL-QGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 96/248 (39%)
Tryp_SPc 76..305 CDD:238113 97/249 (39%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 96/248 (39%)
Tryp_SPc 34..267 CDD:238113 97/249 (39%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587872
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.