DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and gzma

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:243 Identity:78/243 - (32%)
Similarity:115/243 - (47%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRL--LQIDRS 138
            ||||:.|: ....|...:...:::.   |||.||:..:|||||||...:...:|:.:  |.:.:.
Zfish    28 IVGGKDVK-KALSWMVSIQVNQNHK---CGGILIHKEWVLTAAHCKEDSYSSVTVLIGSLSLSKG 88

  Fly   139 SRDPGIVRKVVQTTVHPNYDPNRIVN------DVALLKLESPVPLTGNMRPVCLPEANHNFD-GK 196
            |:         :..:| ||:.....|      |:.|::|...|    ..:|..:|:...:.. |.
Zfish    89 SQ---------RIAIH-NYEIPETFNKKTKKDDIMLIRLSKKV----KAKPYKIPKKEKDVQPGT 139

  Fly   197 TAVVAGWGLIK-EGGVTSNYLQEVNVPVITNAQCRQTRYKDK---IAEVMLCAGLVQQGGKDACQ 257
            ..||.|||... :|...|:.||.:.|.|:...||  .||.::   |.:.|||||..|| .:..|.
Zfish   140 KCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQC--NRYYNRNPVITKDMLCAGNTQQ-HRGTCL 201

  Fly   258 GDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSK-FLDWIRK 304
            |||||||   |....|.||:|..:||.....|.||..:|| .:.||.|
Zfish   202 GDSGGPL---ECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRHITWINK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 75/239 (31%)
Tryp_SPc 76..305 CDD:238113 78/243 (32%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.