DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and gzmk

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:248 Identity:77/248 - (31%)
Similarity:114/248 - (45%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRL--LQIDRS 138
            ||||:.|: ....|...:.|.:.:   .|||.||:.::|||:|.|.......:|:.:  |.:.:.
Zfish    38 IVGGKDVK-KALSWMVSIQKEKIH---ICGGILIHKQWVLTSAQCKEVPVSSVTVLIGSLSLSKG 98

  Fly   139 SRDPGIVRKVVQTTVHPNYDPNRIVN------DVALLKLESPVPLTGNMRPVCLPEANHNF-DGK 196
            |:..||:          ||:..:..|      |:.|::|...|    ..:|..:|:...:. .|.
Zfish    99 SQRIGIL----------NYEIPKTFNEKTKEDDIMLIRLSKKV----KAKPYKIPKNEKDVPPGT 149

  Fly   197 TAVVAGWGLIKEGGVTSNY--------LQEVNVPVITNAQCRQTRYKDK---IAEVMLCAGLVQQ 250
            ..||.|||       |::|        ||.:.|.|:...||  .||.::   |.:.|||||..||
Zfish   150 KCVVRGWG-------TTDYKDEQASDKLQMLEVLVVDRDQC--NRYYNRNPVITKDMLCAGNTQQ 205

  Fly   251 GGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSK-FLDWI 302
             .:..|.|||||||   |.:..|.||:|...||.....|.||..:|| .:.||
Zfish   206 -HRGTCWGDSGGPL---ECKKNLVGVISGSQGCGIPKKPTVYTFLSKRHISWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 75/246 (30%)
Tryp_SPc 76..305 CDD:238113 77/248 (31%)
gzmkXP_017208551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.