DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and zgc:153968

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:246 Identity:98/246 - (39%)
Similarity:136/246 - (55%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG-TPNVNRIVGGQQVRSNKYPWTAQLVKGRHY-PR--LFCGGSLINDRYVLTAAHCVHG-NRDQ 127
            || .|...||:|||...:..:||...:    || |.  |.|||:|||..:||:||.|... ....
Zfish    27 CGRAPLKPRIIGGQTAMAGSWPWQVSI----HYIPTGGLLCGGTLINREWVLSAAQCFQKLTASN 87

  Fly   128 ITIRLLQIDRSSRDPGIVRKVVQTTV-HPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANH 191
            :.:.|..:  |:.||.::.......: ||.||.....||:|||||.:||..|..::||||..:..
Zfish    88 LVVHLGHL--STGDPNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTASGS 150

  Fly   192 NFDGKTAV--VAGWGLIKEGGVT-SNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGK 253
            :. ||.||  :.|||.|..||.. ...||||.:||::|..|: :.|...|.:.|:||| ..:|||
Zfish   151 SL-GKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCK-SAYGSLITDGMICAG-PNEGGK 212

  Fly   254 DACQGDSGGPLIVNEG-RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIR 303
            ..|.||.||||:.|.. ::..:|:.|||.||||...|||:.|||::..||:
Zfish   213 GICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESWIK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 93/235 (40%)
Tryp_SPc 76..305 CDD:238113 94/237 (40%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 93/235 (40%)
Tryp_SPc 36..265 CDD:238113 94/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587763
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.