DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss41

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:277 Identity:98/277 - (35%)
Similarity:144/277 - (51%) Gaps:33/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PKSR--NQCTAKQNCF-------CGTPN--VNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGS 107
            |.||  ||....:|..       ||..|  .:|||||.:....::||.|.| :.|.:.|  ||||
  Rat    22 PGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQASL-RLRKFHR--CGGS 83

  Fly   108 LINDRYVLTAAHCVHGNRD--QITIRLLQIDRS----SRDPGIVRKVVQTTVHPNYDPNRIVNDV 166
            |::.|:|||||||.....|  :.|::|.|:...    :|:....|..|:..:..:.|..: .:|:
  Rat    84 LLSHRWVLTAAHCFRKFLDPKKWTVQLGQLTSKPSFWNREAFSGRYRVKDIIINSEDKLK-YHDL 147

  Fly   167 ALLKLESPVPLTGNMRPVC-LPEANHNFDGKTAVVAGWGLIKEG--GVTSNY-LQEVNVPVITNA 227
            |||:|.|.|.....::||| ||.|:.:.......|.|||.::|.  .:...| |:||.|.|:..:
  Rat   148 ALLRLASSVTYNKFIQPVCVLPSASMSQHQPRCWVTGWGALQEDLKPLPPPYHLREVQVTVLNLS 212

  Fly   228 QCRQ-----TRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQK 286
            :|::     :|| ..|...:.||| .:.|..|.|.|||||||:.| :|.:...|:||.|.||.:.
  Rat   213 RCQELFSFASRY-HLITRDVFCAG-AEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGRP 275

  Fly   287 NAPGVYARVSKFLDWIR 303
            ..||:|..||...|||:
  Rat   276 KLPGIYTNVSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 87/242 (36%)
Tryp_SPc 76..305 CDD:238113 88/244 (36%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 87/242 (36%)
Tryp_SPc 55..292 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.