DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and TPSB2

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:243 Identity:98/243 - (40%)
Similarity:143/243 - (58%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGN-RDQITIRLLQIDRS 138
            |||||:...:|:||...| |:.|::.. |||||||:.::||||||||..: :|...:|:...::.
Human    31 IVGGQEAPRSKWPWQVSLRVRDRYWMH-FCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQH 94

  Fly   139 SRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAG 202
            ......:..|.:..|||.:...:|..|:|||:||.||.::.::..|.||.|:..| .|....|.|
Human    95 LYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTG 159

  Fly   203 WGLI-KEGGVTSNY-LQEVNVPVITNAQCRQTRYK------DKIAEV---MLCAGLVQQGGKDAC 256
            ||.: .:..:...: |::|.||::.|..| ..:|.      |.:..|   |||||..:   :|:|
Human   160 WGDVDNDERLPPPFPLKQVKVPIMENHIC-DAKYHLGAYTGDDVRIVRDDMLCAGNTR---RDSC 220

  Fly   257 QGDSGGPLI--VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            ||||||||:  || |.:..|||||:|.||||.|.||:|.||:.:||||
Human   221 QGDSGGPLVCKVN-GTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 96/241 (40%)
Tryp_SPc 76..305 CDD:238113 98/243 (40%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 98/243 (40%)
Tryp_SPc 31..267 CDD:214473 96/241 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.