DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and PRSS22

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:254 Identity:89/254 - (35%)
Similarity:141/254 - (55%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTP-NVNRIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQ--- 127
            ||.| .:||:|||:....:::||...:.| |.|:    |.|||:..|:|:|||||...|.::   
Human    41 CGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHH----CAGSLLTSRWVITAAHCFKDNLNKPYL 101

  Fly   128 --ITIRLLQI-DRSSRDPGIVRKVVQTTVHPNYD-PNRIVNDVALLKLESPVPLTGNMRPVCLPE 188
              :.:...|: :..||...:  .|.....||.|. ......|:||::||..:..:..:.|:|||:
Human   102 FSVLLGAWQLGNPGSRSQKV--GVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPD 164

  Fly   189 ANHNFDGKT-AVVAGWGLIKEGGVTSN--YLQEVNVPVITNAQCRQTRYK----DKIAEVMLCAG 246
            |:.:....| ..::|||.|::|....:  .||::.||:|.:..|....::    ..|.|.|||||
Human   165 ASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAG 229

  Fly   247 LVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            .: :|.:|||.|||||||:.. :|.:.|||::|:|.|||::|.||||..:|....|:.|
Human   230 YL-EGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/242 (34%)
Tryp_SPc 76..305 CDD:238113 84/245 (34%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.