DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and LOC595077

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_031748571.1 Gene:LOC595077 / 595077 -ID:- Length:752 Species:Xenopus tropicalis


Alignment Length:261 Identity:100/261 - (38%)
Similarity:140/261 - (53%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQLVKGRHYPRLF-CGGSLINDRYVLTAAHCVHGNRDQITI 130
            ||.|.| :|||||...:..::||...|    :|...| ||||||.|.:|:.||||.    |.:.:
 Frog    26 CGVPVVSDRIVGGMNSKKGEWPWQISL----NYKNEFICGGSLITDSWVMAAAHCF----DSLKV 82

  Fly   131 ----------RLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185
                      :|..:|.|:...| |:|:::   :||:.......|:||::||:||..|..:.|||
 Frog    83 SYYTVYLGAYQLSALDNSTVSRG-VKKIIK---NPNFLYEGSSGDIALMELETPVTFTPYILPVC 143

  Fly   186 LPEANHNF-DGKTAVVAGWGLIKEGGVTSN--YLQEVNVPVITNAQCRQTRYKDK---------I 238
            ||...... .|....|.|||..:||...||  .||...|.:|:::.| :..|:..         |
 Frog   144 LPSQEVQLAAGTMCWVTGWGDTQEGIPLSNPKTLQMAEVGIISSSSC-EDMYESSFGYSTGGTFI 207

  Fly   239 AEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLA-GVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            .|.|:||| .|:|..|||||||||||:.|.....|. |:||:|||||:.|.||||.:|..:.||:
 Frog   208 QEDMVCAG-YQEGQIDACQGDSGGPLVCNVNNVWLQFGIVSWGYGCAEPNKPGVYTKVQYYQDWL 271

  Fly   303 R 303
            :
 Frog   272 K 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 95/250 (38%)
Tryp_SPc 76..305 CDD:238113 95/252 (38%)
LOC595077XP_031748571.1 Tryp_SPc 35..272 CDD:238113 95/250 (38%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.