DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG34458

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:234 Identity:81/234 - (34%)
Similarity:125/234 - (53%) Gaps:11/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDR 137
            :||:|||.....::|....| :.|||:    ||||||:|..::|||||..|........::..:.
  Fly    30 SRIIGGQFAAPGQFPHQVSLQLNGRHH----CGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTND 90

  Fly   138 SSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKT-AVVA 201
            .|...|....:.|..:||.|:|.....|::|:||.||||:.|.::.:.|.:::.|:...| |:::
  Fly    91 LSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMIS 155

  Fly   202 GWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV 266
            |:|.|.:.....|.|:...|.:.:...|....... :.:.|:||| ...|...:|||||||||.|
  Fly   156 GFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG-LTDRMVCAG-HPSGQVSSCQGDSGGPLTV 218

  Fly   267 NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKN 305
            :.   ||.||||:|:||..|..|.:|..|.....||::|
  Fly   219 DG---KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 78/228 (34%)
Tryp_SPc 76..305 CDD:238113 79/230 (34%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 78/228 (34%)
Tryp_SPc 32..254 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm25354
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.