DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss21

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:257 Identity:96/257 - (37%)
Similarity:140/257 - (54%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI-- 128
            ||...: :|||||......::||...| |.|.|    .||.:|:|.|:|||||||...:.|..  
Mouse    46 CGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNH----LCGATLLNRRWVLTAAHCFQKDNDPFDW 106

  Fly   129 TIRLLQIDRSSRDPGIVR--------KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185
            |::..::  :|| |.:..        ::....:.|.|. .:..||:|||||.|||.....::|:|
Mouse   107 TVQFGEL--TSR-PSLWNLQAYSNRYQIEDIFLSPKYS-EQYPNDIALLKLSSPVTYNNFIQPIC 167

  Fly   186 LPEANHNFDGKT-AVVAGWGLI--KEGGVTSNYLQEVNVPVITNAQC----RQTRYKDKIAEVML 243
            |..:.:.|:.:| ..|.|||.|  .|...:.|.||||.|.:|.|:.|    ::..::..|...|:
Mouse   168 LLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMV 232

  Fly   244 CAGLVQQGGKDACQGDSGGPLIVNEGR--YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIR 303
            ||| ..:||||||.|||||||..::..  |:: ||||:|.||.:.|.||||..:|...:||:
Mouse   233 CAG-TPEGGKDACFGDSGGPLACDQDTVWYQV-GVVSWGIGCGRPNRPGVYTNISHHYNWIQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 92/246 (37%)
Tryp_SPc 76..305 CDD:238113 93/248 (38%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 92/246 (37%)
Tryp_SPc 55..294 CDD:238113 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.