DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:112 Identity:43/112 - (38%)
Similarity:62/112 - (55%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 LQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNE-GRYKLAGVVSF 279
            ||:..|||:.|:.|... ....|.:.|:||||: |||||.||||||||::..: ..:..:|::|.
Zfish    16 LQQTVVPVVINSDCNNL-LGATITDNMMCAGLL-QGGKDTCQGDSGGPMVSQQCSVWVQSGIISK 78

  Fly   280 GYGCAQKNAPGVYARVSKFLDWIRK------------NTADGCYCQS 314
            |:.|.|...||||.|||::.:||..            |..:.|:..|
Zfish    79 GHDCGQPYEPGVYTRVSQYQNWIMSSINQNLPGFITFNPLNSCFSVS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 38/86 (44%)
Tryp_SPc 76..305 CDD:238113 40/101 (40%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 40/88 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.