DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:278 Identity:79/278 - (28%)
Similarity:126/278 - (45%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYP--RLFCG 105
            |.|..|...|.|                  ..||..||:....::|:  |::....:|  ...||
Mosquito    41 PTEMKIYRQRRP------------------FQRITNGQEATPGQFPY--QIILLSDFPTGTALCG 85

  Fly   106 GSLINDRYVLTAAHCVHGNRDQIT---IRLLQIDRSSRDPGIVRKVVQTT----VHPNYDPNRIV 163
            ||::...::|||||||....:.:.   |.::.....:......:::..|.    .||.|..:.:.
Mosquito    86 GSVLTRNFILTAAHCVVSGTNTVVSGGIAIMGAHNRTIQEASQQRIRYTASGIRYHPLYVSSTLR 150

  Fly   164 NDVALLKLESPVPLTGNMRPVCLPEAN--HNFDGKTAVVAGWGLIKEGGVT-SNYLQEVNVPVIT 225
            .|:|::.|.|.:..|..::||.||..:  ..|.|....::|:|...:...: |..::..:.||:|
Mosquito   151 YDIAVVLLNSSITFTDRIQPVRLPAQSDTRQFGGFVGTLSGFGRTTDASQSISTVVRFTSNPVMT 215

  Fly   226 NAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFG--YGCAQKNA 288
            ||.|........|.:..:|  |...||:.:|.|||||||.|..|.....|||||.  .|| :...
Mosquito   216 NANCITRWGSSNIQDQNVC--LSGTGGRSSCNGDSGGPLTVESGGPIQIGVVSFVSIRGC-EAGM 277

  Fly   289 PGVYARVSKFLDWIRKNT 306
            |.||:|||.:|:|:..|:
Mosquito   278 PSVYSRVSFYLNWVEINS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 72/240 (30%)
Tryp_SPc 76..305 CDD:238113 72/242 (30%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 72/240 (30%)
Tryp_SPc 56..292 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.