DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:234 Identity:76/234 - (32%)
Similarity:119/234 - (50%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSR 140
            |..|.:.:.:..|:...|   :.|....||||||.:.:|||||||...: |.:|:.....|...:
Zfish    24 IQDGTEAKPHSRPYMVSL---QFYKLHMCGGSLITEEFVLTAAHCWEED-DVLTVVTGAHDLRKK 84

  Fly   141 DPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKT-AVVAGWG 204
            ....|.||.....||:::...:.||:.||:|::.|.|:.|:..:.||:...:....| ..|||||
Zfish    85 AINNVYKVKSYIPHPDFNSKTLENDIMLLQLKTKVRLSNNVGLISLPKDGEDVKADTLCSVAGWG 149

  Fly   205 LIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEG 269
            .:...|..::.|:|....::.||:|.:....|.:|..|:|  :...||  .|.|||||||:..: 
Zfish   150 DLWSKGPETDRLREAETVIVNNAECERRWESDYVASKMIC--VYGHGG--TCSGDSGGPLVCGD- 209

  Fly   270 RYKLAGVVSFG--YGCAQKNAPGVYARVSKFLDWIRKNT 306
              .:.|:.|||  |.|..:..|.|:.|:|.:|.||...|
Zfish   210 --TVVGITSFGEPYLCNSRLFPDVHTRISAYLPWIHNIT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 73/228 (32%)
Tryp_SPc 76..305 CDD:238113 75/231 (32%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.