DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tpsab1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:254 Identity:102/254 - (40%)
Similarity:132/254 - (51%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSR 140
            |||||:...||:||...|.....|...|||||||:.::||||||||..|:              .
  Rat    66 IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNK--------------A 116

  Fly   141 DPGIVR---------------KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN 190
            ||..:|               .|.|...||::...:...|:|||||.:||.:|.|:..|.||.|:
  Rat   117 DPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPAS 181

  Fly   191 HNF-DGKTAVVAGWGLI-KEGGVTSNY-LQEVNVPVITNAQCRQTRYK-----DKIAEV---MLC 244
            ..| .|....|.|||.| .:..:...: |:||.||::.|..|....:|     |.:..|   |||
  Rat   182 ETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLC 246

  Fly   245 AGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            ||   ..|.|:|||||||||:.. |..:..|||||:|.||||.|.||:|.||:.:||||
  Rat   247 AG---NEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 100/252 (40%)
Tryp_SPc 76..305 CDD:238113 102/254 (40%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 100/252 (40%)
Tryp_SPc 66..302 CDD:238113 100/252 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.