DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and prss60.2

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:254 Identity:99/254 - (38%)
Similarity:138/254 - (54%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNVN-RIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIR 131
            ||...:| |||||.......:||...|...| |...|||||||:..:|||||||:.|..:...: 
Zfish    25 CGQAPLNSRIVGGVNAPEGSWPWQVSLQSPR-YGGHFCGGSLISSEWVLTAAHCLPGVSESSLV- 87

  Fly   132 LLQIDRSSRDPGI-----VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANH 191
             :.:.|.::. |:     .|.|.:..||.:|:.|...||:|||:|.|.|.....:|||||...|.
Zfish    88 -VYLGRRTQQ-GVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNS 150

  Fly   192 NFD-GKTAVVAGWGLIKEG------GVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQ 249
            .:. |.::.:.|||.::.|      |:    |||..:||:.|.:|........:...|:||||. 
Zfish   151 VYSAGTSSWITGWGDVQAGVNLPAPGI----LQETMIPVVANDRCNAQLGSGTVTNNMICAGLA- 210

  Fly   250 QGGKDACQGDSGGPLIVNEGRYKL------AGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            :||||.||||||||::.     :|      ||:.|:|||||..|:||||.|||::..||
Zfish   211 KGGKDTCQGDSGGPMVT-----RLCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/244 (39%)
Tryp_SPc 76..305 CDD:238113 95/245 (39%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 94/244 (39%)
Tryp_SPc 34..267 CDD:238113 95/245 (39%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587870
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.