DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss44

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:273 Identity:100/273 - (36%)
Similarity:141/273 - (51%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGS 107
            :.||.....||.|.          || ....|||||:.....|:||...| |..:|    .||||
  Rat    92 SRQSFPPWIPPTSA----------CG-HRTARIVGGKPAPIRKWPWQVSLQVHKQH----ICGGS 141

  Fly   108 LINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNR-IVNDVALLKL 171
            ||:..:|:||||||:|:.|.: :.:.:.|..| ...:...|....||.:|...| ||:|:||:.|
  Rat   142 LISKWWVMTAAHCVYGHLDYV-VSMGEADLWS-SMSVKIPVQDIIVHQDYSVMRTIVHDIALVLL 204

  Fly   172 ESPVPLTGNMRPVCLPEANHNFD-GKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYK 235
            ..||..:.|::|||:||.:.... |....|.|||...|.|.:|..|:||::.:|.:.:|.|. .|
  Rat   205 AFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGKTIERGRSSRVLREVDLSIIRHERCNQI-LK 268

  Fly   236 DKIAEVMLCAGLVQQG--------GKDACQGDSGGPLIVNEGR-YKLAGVVSFGYGCAQKNAPGV 291
            |....:..   |||:|        |.||||||||||::....: :...|:||:|.||.:...||:
  Rat   269 DITGRIFT---LVQEGGVCGYNKKGGDACQGDSGGPMVCEFNKTWVQVGIVSWGLGCGRIGYPGI 330

  Fly   292 YARVSKFLDWIRK 304
            |..||.:.|||.|
  Rat   331 YTEVSYYRDWIIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 90/238 (38%)
Tryp_SPc 76..305 CDD:238113 92/241 (38%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 90/238 (38%)
Tryp_SPc 113..341 CDD:238113 89/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.