DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and ACR

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:278 Identity:91/278 - (32%)
Similarity:130/278 - (46%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AKQNCFCGTP-------NVN---RIVGGQQVRSNKYPWTAQLVKGRHYPRLF---------CGGS 107
            ||.|..|..|       |..   |||||:..:...:||...|       ::|         ||||
Human    19 AKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL-------QIFTYNSHRYHTCGGS 76

  Fly   108 LINDRYVLTAAHCVHGNRDQITIRLL----QIDRSSRDP-------GIVRKVVQTTVHPNYDPNR 161
            |:|.|:|||||||..|..:....||:    :|...:..|       ..|.|::   :|..|:...
Human    77 LLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVEKII---IHEKYNSAT 138

  Fly   162 IVNDVALLKLESPVPLTGNMRPVCLP--EANHNFDGKTAVVAGWGLIKEGGV-TSNYLQEVNVPV 223
            ..||:||:::..|:.....:.|.|||  :|......::..|||||.|:|... .|:.|.|..|.:
Human   139 EGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPRPSSILMEARVDL 203

  Fly   224 ITNAQCRQTR-YKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV---NEGRYKLAGVVSFGYGCA 284
            |....|..|: |..::....:||| ...|..|.|||||||||:.   .|..|.:.|:.|:|.|||
Human   204 IDLDLCNSTQWYNGRVQPTNVCAG-YPVGKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCA 267

  Fly   285 QKNAPGVYARVSKFLDWI 302
            :...||:|.....:|:||
Human   268 RAKRPGIYTATWPYLNWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/253 (33%)
Tryp_SPc 76..305 CDD:238113 84/254 (33%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 83/253 (33%)
Tryp_SPc 43..288 CDD:238113 84/254 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4320
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.