DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and MST1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:267 Identity:75/267 - (28%)
Similarity:118/267 - (44%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLIND 111
            :|:|..|.:|.          ||.......|..::          :|.:|:|    ||||||:.:
Human   500 AIRATHPGQSA----------CGIGEAQLPVSHRE----------ELRQGQH----FCGGSLVKE 540

  Fly   112 RYVLTAAHCVHGNRDQIT-----IRLLQIDRSSRDPGIVR-KVVQTTVHPNYDPNRIVNDVALLK 170
            :::|||..|.......:|     :..|..:....:|.:.| .|.:....|:      .:.:.|||
Human   541 QWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPS------GSQLVLLK 599

  Fly   171 LESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRY 234
            ||..|.|...:..:|||...:.. .|....:||||..|..| ....|....:.||:|.:| ..::
Human   600 LERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTG-NDTVLNVALLNVISNQEC-NIKH 662

  Fly   235 KDKIAEVMLCA-GLVQQGGKDACQGDSGGPL-IVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSK 297
            :.::.|..:|. ||:...|  ||:||.|||| ......:.|.|::.....||:...|.|:.|||.
Human   663 RGRVRESEMCTEGLLAPVG--ACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSV 725

  Fly   298 FLDWIRK 304
            |:|||.|
Human   726 FVDWIHK 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 66/235 (28%)
Tryp_SPc 76..305 CDD:238113 69/238 (29%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.