DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and zgc:92313

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:255 Identity:100/255 - (39%)
Similarity:144/255 - (56%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG-TPNVNRIVGGQQVRSNKYPWTAQL--VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQIT 129
            || .|.:||||||.......:||...:  .|.:|    .|||::|::.:||:|||| ..|.:.|:
Zfish    26 CGRPPMINRIVGGSSAADGAWPWQVDIQGEKSKH----VCGGTIISENWVLSAAHC-FPNPNDIS 85

  Fly   130 IRLLQIDR---SSRDPGIVRKVVQTTVHP-NYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN 190
            ..|:...|   :..:|......:...|.| .|...::..|:||::|.:|...|..::|||||.||
Zfish    86 GYLIYAGRQQLNGWNPDETSHRISRVVVPLGYTDPQLGQDIALVELATPFVYTERIQPVCLPYAN 150

  Fly   191 HNF-DGKTAVVAGWGLIKEG----GVTSNYLQEVNVPVITNAQCRQTRYKDKIAEV-----MLCA 245
            ..| .....::.|||.|:||    ||  ..||||.||:|.:..|:.....:....:     |:||
Zfish   151 VEFTSDMRCMITGWGDIREGVALQGV--GPLQEVQVPIIDSQICQDMFLTNPTENIDIRPDMMCA 213

  Fly   246 GLVQQGGKDACQGDSGGPLI--VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIR 303
            |. ||||||:|||||||||.  :::|.:..||:||||.|||:.|.|||||:||.|.::|:
Zfish   214 GF-QQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGLGCAEANRPGVYAKVSSFTNFIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 95/244 (39%)
Tryp_SPc 76..305 CDD:238113 95/246 (39%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 95/244 (39%)
Tryp_SPc 35..274 CDD:238113 95/246 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.