DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG11313

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:378 Identity:105/378 - (27%)
Similarity:161/378 - (42%) Gaps:84/378 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVYLALPLLLLGIGLSLAQY-QYQAPHQ--------TLAQQFADVVDVVDPAEQSIKAVR---- 52
            |:|..|:.|.||.|..:..|| ..:.|:|        .|......|:...:|.:..::.:|    
  Fly     1 MKVIAAVLLCLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRC 65

  Fly    53 --------------PPKSRNQCTAKQN------------CFCGTP-NVNRIVGGQQVRSNKYPWT 90
                          |....|...|:.|            ..||.. ..|:|..|.:....::.|.
  Fly    66 LVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWM 130

  Fly    91 AQLVKGRH---YPRLFCGGSLINDRYVLTAAHCVHGNRD--------QITIRLLQIDRSS----- 139
            ..|....|   ..|.:|.|||||:|||:||||||.....        ::::||.:.:.|:     
  Fly   131 VLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCL 195

  Fly   140 -----RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPE--ANHNF-DGK 196
                 .:| :...|.:..:|.::......||:||::|...|..:.::||||||.  ...|: .|:
  Fly   196 NGRCLPEP-VQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQ 259

  Fly   197 TAVVAGWG--LIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVM------LCAGLVQQGGK 253
            ...|||||  |..|   :|....::.|..:....||:     |.|.::      |||....:|  
  Fly   260 AFTVAGWGRTLTSE---SSPVKMKLRVTYVEPGLCRR-----KYASIVVLGDSHLCAEGRSRG-- 314

  Fly   254 DACQGDSGGPLIV-NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKN 305
            |:|.|||||||:. :||.:.|.|:||||..|..:..|.||..|..:..||.:|
  Fly   315 DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 80/259 (31%)
Tryp_SPc 76..305 CDD:238113 82/261 (31%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 6/53 (11%)
Tryp_SPc 116..367 CDD:238113 82/261 (31%)
Tryp_SPc 116..364 CDD:214473 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.