DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG9733

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:271 Identity:99/271 - (36%)
Similarity:143/271 - (52%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQLVKGRHYPR-------LFCGGSLINDRYVLTAAHCVHGN 124
            ||...: |||..||....|::||...|    .|.|       ..|.|||||.|||||||||:.|.
  Fly   153 CGGVGIRNRIYDGQDTDVNEFPWMVLL----EYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGR 213

  Fly   125 RDQ-----ITIRLLQID-RSSRD--PG------IVRKV--VQTTVHPNYD--PNRIVNDVALLKL 171
            .::     :::||.:.| |::.|  ||      .|:::  .:..||..|.  .:..|:|:.|:::
  Fly   214 IEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRM 278

  Fly   172 ESPVPLTGNMRPVCLPEA---NHNFDGKTAVVAGWG-LIKEGGVTSNYLQEVNVPVITNAQCRQ- 231
            |..|..:.|::|:|||.:   .....|:...||||| .:|.  ..|...|:|.|..:..|:||| 
  Fly   279 ERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKM--ARSAVKQKVTVNYVDPAKCRQR 341

  Fly   232 -TRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLI-VNEGRYKLAGVVSFGYGCAQKNAPGVYAR 294
             ::.|..:....||||  .|..||:|.|||||||: ..:..:.|.|:|||||.|..|:.||||..
  Fly   342 FSQIKVNLEPTQLCAG--GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTN 404

  Fly   295 VSKFLDWIRKN 305
            |:.:..|||:|
  Fly   405 VAAYDIWIRQN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 92/258 (36%)
Tryp_SPc 76..305 CDD:238113 94/260 (36%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 92/258 (36%)
Tryp_SPc 162..415 CDD:238113 94/260 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.