DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG7432

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:289 Identity:103/289 - (35%)
Similarity:144/289 - (49%) Gaps:44/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTP--NVNRIVGGQQVRSNKYPWTAQL-VKGRHYP 100
            ::|||.|                      ||..  :..|||||.:..:.::||.|.: :.|....
  Fly   458 NIVDPDE----------------------CGQQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRT 500

  Fly   101 RLFCGGSLINDRYVLTAAHCVHGNRD------QITIRLLQIDRSS----RDPGIVRKVVQTTVHP 155
            ..:||||||..:|:||||||...:|.      |.|:||..||.|:    .|| :...|.:...|.
  Fly   501 EFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDP-VTFAVKEVRTHE 564

  Fly   156 NYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEA-----NHNFDGKTAVVAGWGLIKEGGVTSNY 215
            .:......||:|:|.|:.||..:..:.|||||:.     .....|:.|.|.|||....||..|..
  Fly   565 RFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTS 629

  Fly   216 LQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSF 279
            .::..:|:..|..|.:: |...|.|..:||| ...||.|||||||||||::. :..:...|||||
  Fly   630 QRQAELPIWRNEDCDRS-YFQPINENFICAG-YSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSF 692

  Fly   280 GYGCAQKNAPGVYARVSKFLDWIRKNTAD 308
            |..|.:...||||.||:::|||||.:|.|
  Fly   693 GNKCGEPGYPGVYTRVTEYLDWIRDHTRD 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 92/243 (38%)
Tryp_SPc 76..305 CDD:238113 94/245 (38%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 92/243 (38%)
Tryp_SPc 475..718 CDD:238113 94/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.