DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG14892

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:441 Identity:104/441 - (23%)
Similarity:142/441 - (32%) Gaps:191/441 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QSIKAVRP-------PKSRNQCTAKQNCFCGTPNVN----------------------------- 74
            ||....||       |:||:|..::..|....|..:                             
  Fly    12 QSQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPAR 76

  Fly    75 ---RIVGGQQVRSNKYPWTAQLVKGRHYPRL-----FCGGSLINDRYVLTAAHCVHGNRDQI--- 128
               ||:.|......::||.|.|  ...:|.|     :||..||:..::|:||||||.:...:   
  Fly    77 RGPRIIAGAATNEGQFPWQASL--ELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIP 139

  Fly   129 ---TIRLLQIDR------SSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLT--GNMR 182
               |:.|.:.||      ..|.|  |.|:|   :|..|  :...:||.|:||..|..||  .|:|
  Fly   140 PLWTVVLGEHDRDVESGNEQRIP--VEKIV---MHHRY--HNFKHDVVLMKLSKPADLTRASNIR 197

  Fly   183 PVCLP----------------------------------------------EANHNFDGKTA--- 198
            .:|||                                              ::...:...||   
  Fly   198 RICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSM 262

  Fly   199 ----------------------------------------------------------------- 198
                                                                             
  Fly   263 KELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVD 327

  Fly   199 -VVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKD--KIAEVMLCAG-LVQQGGKDACQGD 259
             |..|||.....|..||.|.:..||:..|.:||.. |..  .|....|||| |..:||  .|.||
  Fly   328 CVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDA-YGSFVNIHGGHLCAGKLNGEGG--TCVGD 389

  Fly   260 SGGPL---IVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            |||||   :..:|.:.|.||.|||.|||.:..|.||.|.|.::.||....|
  Fly   390 SGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/366 (25%)
Tryp_SPc 76..305 CDD:238113 92/368 (25%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 91/366 (25%)
Tryp_SPc 81..438 CDD:238113 92/368 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.