DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Sb

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:307 Identity:111/307 - (36%)
Similarity:164/307 - (53%) Gaps:32/307 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQYQYQAPHQT--LAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNV----NRIV 77
            :|...|..|:|  ||....:..::.|.:.....|:...|:.:...::    ||.|.:    .|||
  Fly   485 SQRPTQPTHRTPVLATSGIETNEISDSSIPDAGALGHVKTISAARSE----CGVPTLARPETRIV 545

  Fly    78 GGQQVRSNKYPWTAQL-------VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNR-DQITIRLLQ 134
            ||:.....::||...:       ....|.    |||:|||:.::.||.|||.... .||.||:.:
  Fly   546 GGKSAAFGRWPWQVSVRRTSFFGFSSTHR----CGGALINENWIATAGHCVDDLLISQIRIRVGE 606

  Fly   135 IDRS---SRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGK 196
            .|.|   .:.|.|.|.|.:..|||.|.......|:||:|||.|:....::.|:||||.:....|.
  Fly   607 YDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETDSLLIGM 671

  Fly   197 TAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCR----QTRYKDKIAEVMLCAGLVQQGGKDACQ 257
            .|.|.|||.:.|||...:.||||:||:::|..|:    :...::.|.::.|||| .:.||:|:||
  Fly   672 NATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAG-YETGGQDSCQ 735

  Fly   258 GDSGGPLIV--NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            |||||||..  .:||:.|||::|:|.|||:.|.|||..|:|||..||
  Fly   736 GDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 97/243 (40%)
Tryp_SPc 76..305 CDD:238113 98/244 (40%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 97/243 (40%)
Tryp_SPc 544..785 CDD:238113 98/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.