DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Try10

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:239 Identity:90/239 - (37%)
Similarity:138/239 - (57%) Gaps:21/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRL----LQ 134
            ::||||...:.|..|:...|..|.|    ||||||||:::|::||||.   :.:|.:||    :.
  Rat    22 DKIVGGYTCQENSVPYQVSLNSGYH----FCGGSLINEQWVVSAAHCY---KSRIQVRLGEHNIN 79

  Fly   135 IDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAV 199
            :...:.......|:::   |||:....:.||:.|:||.|||.|...:..|.||.:... .|...:
  Rat    80 VLEGNEQFVNAAKIIK---HPNFIRKTLNNDIMLIKLSSPVKLNSRVATVALPSSCAP-AGTQCL 140

  Fly   200 VAGWGLIKEGGVTS-NYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGP 263
            ::|||.....||.. :.||.::.|::..|.| :..|..||.:.|:|||.: :||||:||||||||
  Rat   141 ISGWGNTLSFGVNEPDLLQCLDAPLLPQADC-EASYPGKITDNMVCAGFL-EGGKDSCQGDSGGP 203

  Fly   264 LIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            ::.|.   :|.|:||:|||||..:.||||.:|..::|||:...|
  Rat   204 VVCNG---ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 87/231 (38%)
Tryp_SPc 76..305 CDD:238113 89/233 (38%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 87/231 (38%)
Tryp_SPc 24..242 CDD:238113 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.