DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:301 Identity:101/301 - (33%)
Similarity:154/301 - (51%) Gaps:33/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QYQAPHQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCF----CG----TPNVNRIVG 78
            ::::.::...::|.|.|:.:        ..:..||:.:.....:.|    ||    ||..:::.|
  Rat   133 KFKSCYKNNVEKFWDSVETI--------LYQKLKSQTRLLIDSSSFKFSGCGRRTITPGGHKVAG 189

  Fly    79 GQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRD----QITIRLLQIDRSS 139
            ||.....::||.|.|.:...:.   ||.:||::.:::|||||...:.:    :::...|     .
  Rat   190 GQDAEEGEWPWQASLQQNNVHR---CGATLISNSWLITAAHCFVRSANPKDWKVSFGFL-----L 246

  Fly   140 RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGW 203
            ..|...|.|....:|.||......||:|:::|.|||....|:|..|||||...| .....||.||
  Rat   247 SKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGW 311

  Fly   204 GLIKEGGVTSNYLQEVNVPVITNAQCRQTR-YKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV- 266
            |.:|..|.:.|.||:..|.:|.|..|...: |...|...|||||.: :|..|||||||||||:. 
  Rat   312 GTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFL-EGRVDACQGDSGGPLVSE 375

  Fly   267 -NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
             ::|.:.|||:||:|..||..|.||||.||:.:.|||...|
  Rat   376 DSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 88/234 (38%)
Tryp_SPc 76..305 CDD:238113 90/236 (38%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 3/31 (10%)
Tryp_SPc 186..412 CDD:214473 88/234 (38%)
Tryp_SPc 187..415 CDD:238113 90/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.