DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG6865

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:280 Identity:94/280 - (33%)
Similarity:146/280 - (52%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QCTAKQNCF----CGTPNVNRIVGGQQVRSNKYPWTAQLV-KGRHYPRLFCGGSLINDRYVLTAA 118
            :|...|..|    |...| .:||||.:...|:.|:...|: :|.|    ||||::|::|::|||.
  Fly    15 KCAQSQIAFSNQPCSVRN-PKIVGGSEAERNEMPYMVSLMRRGGH----FCGGTIISERWILTAG 74

  Fly   119 HCVHGNRDQITIRLLQID-----RSSRD--------PGIVRKVVQTTV-HPNYDPNRIVNDVALL 169
            ||:.....|. ::..||.     .|.|:        |..:|...:..| ||.||.|.:.:|:|||
  Fly    75 HCICNGLQQF-MKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALL 138

  Fly   170 KLESPVPLTGNMRPVCL--PEANHNFDGKTAVVAGWGLIKEGGV---TSNYLQEVNVPVITNAQC 229
            :|..|:..:.:::|.|:  .|.:.:.:.:...|:|||...|...   .|:.|::..|.:..|..|
  Fly   139 ELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVLRKATVKIWNNEAC 203

  Fly   230 RQTRYK-----DKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAP 289
            .:: |:     :.|.|..|||| .:.|..|:|..||||||:..|  :.|.||||.|.|||:...|
  Fly   204 ERS-YRSLGKSNTIGETQLCAG-YENGQIDSCWADSGGPLMSKE--HHLVGVVSTGIGCARPGLP 264

  Fly   290 GVYARVSKFLDWIRKNTADG 309
            |:|.||||::.|::| ..||
  Fly   265 GIYTRVSKYVSWMQK-VIDG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 85/251 (34%)
Tryp_SPc 76..305 CDD:238113 86/253 (34%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 85/250 (34%)
Tryp_SPc 35..280 CDD:238113 87/254 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.