DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG4613

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:258 Identity:157/258 - (60%)
Similarity:195/258 - (75%) Gaps:10/258 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVH 122
            |:|.   :|.||.|||||||||.|||:|||||.||:::|..   |||||:|||||||||||||||
  Fly   122 NRCA---SCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTF---LFCGGTLINDRYVLTAAHCVH 180

  Fly   123 G-NRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCL 186
            | :...:::||||:||||...|:.|.|.....|..|||..:|:|:|||:|:.|:||...|||.||
  Fly   181 GMDMRGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL 245

  Fly   187 PEAN--HNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQ 249
            | :|  .|||.:.|:||||||.:|||.||:.||||.||:|||||||.|.|:..|.:.|:|||.|:
  Fly   246 P-SNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVK 309

  Fly   250 QGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTADGCYC 312
            .||:|||||||||||||.:..::||||||||||||:.:|||||.|||::|:||..||.|.|||
  Fly   310 TGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTRDSCYC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 140/229 (61%)
Tryp_SPc 76..305 CDD:238113 141/231 (61%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 140/229 (61%)
Tryp_SPc 137..362 CDD:238113 139/228 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471759
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.