DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG4477

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:277 Identity:67/277 - (24%)
Similarity:106/277 - (38%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNCFCGTPNVNRIVGGQ-------------QVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVL 115
            :|.|.....|.|:..|.             .:||.    :|:...|.::   ||.|.::...:|:
  Fly    26 RNAFSSLNRVKRLSDGDFDEDSIALSNYCVSLRSR----SAEKFFGDNH---FCSGVILAPMFVM 83

  Fly   116 TAAHC-VHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIV---------------- 163
            |:||| ::..|..|:.|:|.|            |..|.....|.|||..                
  Fly    84 TSAHCLINKRRVLISSRVLLI------------VAGTLNRLKYIPNRTFVTPVTHIWLPDSFTMR 136

  Fly   164 --NDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITN 226
              .|..|||:::|.|.......:.....:....|....|.|||.:.:||..::|:..::|.||.:
  Fly   137 NKQDFGLLKVKNPFPRNNEHISIARLPVHPPLPGLKCKVMGWGRMYKGGPLASYMLYIDVQVIDS 201

  Fly   227 AQCRQTRYKDKIAEVMLCA----GLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKN 287
            ..|.:......:..|  ||    .|..|   ..|.||.|.|::.|...|   |:|:...||...:
  Fly   202 EACAKWLRVPSVEHV--CAVDSDDLTAQ---QPCGGDWGAPMLHNGTVY---GIVTILAGCGVSH 258

  Fly   288 APGVYARVSKFLDWIRK 304
            .|.:|..|....:||.:
  Fly   259 LPSLYTNVHSNANWIHE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 62/262 (24%)
Tryp_SPc 76..305 CDD:238113 63/265 (24%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 62/248 (25%)
Tryp_SPc 55..273 CDD:214473 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.