DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and mas

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:306 Identity:100/306 - (32%)
Similarity:157/306 - (51%) Gaps:39/306 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLAQYQYQAPHQTLAQQFADVVDVVDP---AEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVG 78
            ||...|.::.|...||  ||..|:|.|   .::|:..:            |:.|.|.... |:||
  Fly   756 SLQSNQLRSYHNHQAQ--ADQPDLVYPEYYQQRSLYGL------------QSNFSGRRRA-RVVG 805

  Fly    79 GQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG---NRDQITIRLLQID--RS 138
            |:...:.::.|...|:...:  :..||.:||..::||||||||..   :.|.|.:|:...|  |.
  Fly   806 GEDGENGEWCWQVALINSLN--QYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTRK 868

  Fly   139 SRDPGI-VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN-HNFDGKTAVVA 201
            ...||. ..:|..|.:|.|::...:.||:|||||.....|...:..||||... .:..||...|.
  Fly   869 YGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCTVT 933

  Fly   202 GWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVM-------LCAGLVQQGGKDACQGD 259
            |:|.:.|.|.....::|..:|::::.:|  .|..:.:.|.:       .|||  .:.|.||||||
  Fly   934 GYGYMGEAGPIPLRVREAEIPIVSDTEC--IRKVNAVTEKIFILPASSFCAG--GEEGHDACQGD 994

  Fly   260 SGGPLIV-NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            .||||:. ::|.|:|||:||:|:||.:::.||||.:.|.|:.||.:
  Fly   995 GGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQ 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/241 (34%)
Tryp_SPc 76..305 CDD:238113 84/244 (34%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.