DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG30414

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:281 Identity:80/281 - (28%)
Similarity:119/281 - (42%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPN---VNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI- 128
            |||..   :..|.||........||..:::..:     .||||||..|:|||||||:.....:: 
  Fly    30 CGTTKPEFIPMITGGADAGLFSNPWMVKVLGEK-----LCGGSLITSRFVLTAAHCIVSTHMRVR 89

  Fly   129 ------------------------TIRLLQIDRSSRDPG------------IVRKVVQTTVHPNY 157
                                    .|||.:.|  :|.||            :.||:    :|.:|
  Fly    90 LGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD--TRFPGKDCCVPKSYELAVDRKI----LHADY 148

  Fly   158 DPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVP 222
            :.| :.||:.||:::|.|..:..:||:||....|..:.....:.|||:..: |..|..||...|.
  Fly   149 NLN-LDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVTND-GTPSRRLQRATVY 211

  Fly   223 VITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAG---VVSFG---Y 281
            ......|| :::..::.|..:||.   ....|||.|||||||   ..:...||   ...:|   |
  Fly   212 NTDLHFCR-SKFTKQVDESQICAA---GTNSDACHGDSGGPL---SAQVPFAGSWLTFQYGLVSY 269

  Fly   282 GCAQKNAPGVYARVSKFLDWI 302
            |.|..::..||..|:...|||
  Fly   270 GSAACHSFSVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 75/269 (28%)
Tryp_SPc 76..305 CDD:238113 77/270 (29%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 75/268 (28%)
Tryp_SPc 41..290 CDD:238113 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.