DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Ser8

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:236 Identity:81/236 - (34%)
Similarity:122/236 - (51%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138
            |||||........||...|.: |.|    |||||:|::..::|||||:.   ...|:..|:|...
  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSH----FCGGSIISNNIIVTAAHCLD---TPTTVSNLRIRAG 91

  Fly   139 SRD---PGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN--HNFDGKTA 198
            |..   .|::.:|.....|..|:.|..:||:.:::|::.:.....::.:.:..|.  |   |..|
  Fly    92 SNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAH---GSAA 153

  Fly   199 VVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTR--YKDKIAEVMLCAGLVQQGGKDACQGDSG 261
            .::|||.....|.:|..|..|:..::..:||..:.  |...|...|:||...   .|||||||||
  Fly   154 SISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAAT---NKDACQGDSG 215

  Fly   262 GPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            ||| |:.|  :|.||||:|..||..|.|||||.:::..||:
  Fly   216 GPL-VSGG--QLVGVVSWGRDCAVANYPGVYANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 80/234 (34%)
Tryp_SPc 76..305 CDD:238113 80/235 (34%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/234 (34%)
Tryp_SPc 35..253 CDD:238113 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.