DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and thetaTry

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:98/272 - (36%)
Similarity:131/272 - (48%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CTAKQNCFCGTPNVN---------RIVGGQQVRSNKYPW--TAQLVKGRHYPRLFCGGSLINDRY 113
            |.|..:...||..|:         |||||:......:|:  :.|...|.|    ||||||||:..
  Fly    10 CLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSH----FCGGSLINEDT 70

  Fly   114 VLTAAHCVHGNR-DQITIRLLQIDRSS--RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPV 175
            |:|||||:.|.: .::.:||    .|:  .:.|||..|.:...:.:|:...:..||.:|||:..|
  Fly    71 VVTAAHCLVGRKVSKVFVRL----GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKV 131

  Fly   176 PLTGNMRPVCL----PEANHNFDGKTAVVAGWG---------LIKEGGVTSNYLQEVNVPVITNA 227
            ..|.|:|.:.|    |..     |.||||.|||         |.|.       ||||.|.::...
  Fly   132 KETENIRYIELATETPPT-----GTTAVVTGWGSKCYFWCMTLPKT-------LQEVYVNIVDWK 184

  Fly   228 QCRQTRYK--DKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPG 290
            .|....||  :.|.:.|:||   .:..||||||||||||.|..   .|.|:||:||.||....||
  Fly   185 TCASDEYKYGEIIYDSMVCA---YEKKKDACQGDSGGPLAVGN---TLVGIVSWGYACASNLLPG 243

  Fly   291 VYARVSKFLDWI 302
            ||:.|.....||
  Fly   244 VYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/246 (37%)
Tryp_SPc 76..305 CDD:238113 92/247 (37%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 91/246 (37%)
Tryp_SPc 35..255 CDD:238113 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.