DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and PRSS41

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:257 Identity:91/257 - (35%)
Similarity:138/257 - (53%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNVNRIV-GGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCV--HGNRDQI 128
            ||...::.:| ||.:....::||.|.| ::.||.    |||||::.|:||:||||.  |....:.
Human    62 CGHREIHALVAGGVESARGRWPWQASLRLRRRHR----CGGSLLSRRWVLSAAHCFQKHYYPSEW 122

  Fly   129 TIRLLQIDRSSRDPGIVR------KVVQTTVHPNYDPNRIV-NDVALLKLESPVPLTGNMRPVCL 186
            |::|.:: .|...|..:|      ||....|:|  |...:: ||:|||:|.|.|.....::|:|:
Human   123 TVQLGEL-TSRPTPWNLRAYSSRYKVQDIIVNP--DALGVLRNDIALLRLASSVTYNAYIQPICI 184

  Fly   187 PEANHNFDGK-TAVVAGWGLIKEGG--VTSNY-LQEVNVPVITNAQC----RQTRYKDKIAEVML 243
            ..:..||..: ...|.|||||...|  :...| |:|..|.::.|.:|    .|...:..|.:.|.
Human   185 ESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWDSMF 249

  Fly   244 CAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ||| .:.|..|.|:|||||||:.: :|.:...|:||:|..|.|.|.||||..:|.:..|||:
Human   250 CAG-AEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFHWIRR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 86/246 (35%)
Tryp_SPc 76..305 CDD:238113 89/249 (36%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.