DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG13744

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:326 Identity:104/326 - (31%)
Similarity:155/326 - (47%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QYQYQAPHQTLAQQFADVVDV------VDPAEQSIKAVR-------PPKSRNQCTAKQNCFCGTP 71
            |:.:|..|.:.:...|::||.      ::...:.|...|       .||..          ||.|
  Fly    77 QHPHQQQHHSPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPE----------CGVP 131

  Fly    72 NV------NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCV-HGNRDQIT 129
            ..      .||:||:..:..:|||.|.:....:.    |||.||:...|.|||||: ..:...||
  Fly   132 RTAQNTLQKRIIGGRPAQFAEYPWQAHIRIAEYQ----CGGVLISANMVATAAHCIQQAHLADIT 192

  Fly   130 IRLLQIDRSS----RDPGIVRK--VVQTTVHPNYD-----PNRIVNDVALLKLESPVPLTGNMRP 183
            :.|.::|...    .:|..|.|  |:|..:||.::     |:|.  |:|||||..|...|.::.|
  Fly   193 VYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY--DIALLKLAQPTSFTEHILP 255

  Fly   184 VCLPEANHNFDGKTAVVAGWGLIKE--GGVTSNYLQEVNVPVITNAQC----RQTRYKDKIAEVM 242
            :|||:......|:..::||||..:.  |...:|.||..:||:||...|    ...:...:|...|
  Fly   256 ICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEM 320

  Fly   243 LCAGLVQQGGKDACQGDSGGPLIVNE-GRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
            .||| ...|..|||.|||||||::.| ||:.|.|:.|.|:||...:.||:|..|.|.:.||::..
  Fly   321 FCAG-HSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVV 384

  Fly   307 A 307
            |
  Fly   385 A 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 88/245 (36%)
Tryp_SPc 76..305 CDD:238113 89/247 (36%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 88/245 (36%)
Tryp_SPc 142..383 CDD:238113 89/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.